PDB entry 4u5x

View 4u5x on RCSB PDB site
Description: Structure of plant small GTPase OsRac1 complexed with the non-hydrolyzable GTP analog GMPPNP
Class: GTP-binding protein
Keywords: Small GTPase, Rac, Plant
Deposited on 2014-07-25, released 2014-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rac-like GTP-binding protein 1
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: RAC1, Os01g0229400, LOC_Os01g12900
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SSX0 (2-177)
      • expression tag (0-1)
      • engineered mutation (26)
      • engineered mutation (62)
    Domains in SCOPe 2.06: d4u5xa1, d4u5xa2
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u5xA (A:)
    gstrfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvsvdgsvvnlglwdt
    agledysrlrplsyrgadvfilsfslisrasyenvqkkwmpelrrfapgvpvvlvgtkld
    lredrayladhpassiitteqgeelrkligavayiecssktqrnikavfdtaikvvlq