PDB entry 4u5k

View 4u5k on RCSB PDB site
Description: Complex structure of mutant CtCel5E (E314A) with cellobiose
Class: hydrolase
Keywords: bi-functional cellulase/xylanase, HYDROLASE
Deposited on 2014-07-25, released 2015-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase h
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (313)
    Domains in SCOPe 2.06: d4u5ka_
  • Chain 'B':
    Compound: endoglucanase h
    Species: Clostridium thermocellum ATCC 27405 [TaxId:203119]
    Gene: celH, Cthe_1472
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218
      • engineered mutation (313)
    Domains in SCOPe 2.06: d4u5kb_
  • Heterogens: CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u5kA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtfhyydpyefthkwrgtwgtqedmdtvvrvfdfvk
    swsdrnnipvyfgafavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndma
    iynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5kA (A:)
    pkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnh
    tmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqia
    erfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntl
    vnikipddpyligtfhyydpyefthkwrgtwgtqedmdtvvrvfdfvkswsdrnnipvyf
    gafavmayadrtsrvkwydfisdaalergfacsvwdngvfgdndmaiynrdtrtfdteil
    nalf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u5kB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgriegrefsspealaayreaigagssnptp
    tptwtstppssspkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagy
    knvripvrwdnhtmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngn
    ierfekiweqiaerfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptrivi
    igggywnsyntlvnikipddpyligtfhyydpyefthkwrgtwgtqedmdtvvrvfdfvk
    swsdrnnipvyfgafavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndma
    iynrdtrtfdteilnalfnpgtypsyspkpsptprptkppvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5kB (B:)
    pkavdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnh
    tmrtypytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqia
    erfknksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntl
    vnikipddpyligtfhyydpyefgtwgtqedmdtvvrvfdfvkswsdrnnipvyfgafav
    mayadrtsrvkwydfisdaalergfacsvwdngvfgndmaiynrdtrtfdteilnalf