PDB entry 4u54

View 4u54 on RCSB PDB site
Description: importin-alpha minor nls site inhibitor
Class: transport protein
Keywords: TPX2 inhibitor, transport protein
Deposited on 2014-07-24, released 2015-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u54a_
  • Heterogens: 3C5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u54A (A:)
    vnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdc
    spiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdg
    safrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqil
    ptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpa
    lraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqv
    vnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakd
    tkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnlie
    kyfsv