PDB entry 4u3w

View 4u3w on RCSB PDB site
Description: X-ray crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase from Burkholderia cenocepacia
Class: oxidoreductase
Keywords: dehydrogenase aminomuconate, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2014-07-23, released 2014-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: nbaE, BCAM2132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u3wa_
  • Chain 'B':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: nbaE, BCAM2132
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u3wb_
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u3wA (A:)
    mahhhhhhmvttqlnstsrdrqllrhyingefvasgttfpnlspvdgrkladvceadaal
    vdsavqaahaaqkagwrdttpaqraawlhkiadgiearfdefvaaevadtgrpvaqartl
    diargianfrtfadlvrtasgeyfethaadgselinyvtrkplgvigiispwnlplllft
    wkvapalamgncvvakpseetpssatllaevmhdvglppgvfnlihghgqnaagefltrh
    pdisaitftgesrtgstimkavadgvkevsfelggknaavvfadadfdaavagvlrssft
    nagqvclcservyverpiferfvaalkeqaqalrvgapedpattmgplisrghrdkvlsy
    frlaveegatvvtgggapsfgdarddgafvmptiwtglpdsarcvreeifgpvchiapfd
    deaevvkrvndsayglaasiwttqlarghrvakqietgivwvnawfvrdlrtpfggtkls
    glgreggrhsldfyseltnvcvria
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u3wA (A:)
    rqllrhyingefvasgttfpnlspvdgrkladvceadaalvdsavqaahaaqkagwrdtt
    paqraawlhkiadgiearfdefvaaevadtgrpvaqartldiargianfrtfadlvrtas
    geyfethaadgselinyvtrkplgvigiispwnlplllftwkvapalamgncvvakpsee
    tpssatllaevmhdvglppgvfnlihghgqnaagefltrhpdisaitftgesrtgstimk
    avadgvkevsfelggknaavvfadadfdaavagvlrssftnagqvclcservyverpife
    rfvaalkeqaqalrvgapedpattmgplisrghrdkvlsyfrlaveegatvvtgggapsf
    gdarddgafvmptiwtglpdsarcvreeifgpvchiapfddeaevvkrvndsayglaasi
    wttqlarghrvakqietgivwvnawfvrdlrtpfggtklsglgreggrhsldfyseltnv
    cvria
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u3wB (B:)
    mahhhhhhmvttqlnstsrdrqllrhyingefvasgttfpnlspvdgrkladvceadaal
    vdsavqaahaaqkagwrdttpaqraawlhkiadgiearfdefvaaevadtgrpvaqartl
    diargianfrtfadlvrtasgeyfethaadgselinyvtrkplgvigiispwnlplllft
    wkvapalamgncvvakpseetpssatllaevmhdvglppgvfnlihghgqnaagefltrh
    pdisaitftgesrtgstimkavadgvkevsfelggknaavvfadadfdaavagvlrssft
    nagqvclcservyverpiferfvaalkeqaqalrvgapedpattmgplisrghrdkvlsy
    frlaveegatvvtgggapsfgdarddgafvmptiwtglpdsarcvreeifgpvchiapfd
    deaevvkrvndsayglaasiwttqlarghrvakqietgivwvnawfvrdlrtpfggtkls
    glgreggrhsldfyseltnvcvria
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u3wB (B:)
    qllrhyingefvasgttfpnlspvdgrkladvceadaalvdsavqaahaaqkagwrdttp
    aqraawlhkiadgiearfdefvaaevadtgrpvaqartldiargianfrtfadlvrtasg
    eyfethaadgselinyvtrkplgvigiispwnlplllftwkvapalamgncvvakpseet
    pssatllaevmhdvglppgvfnlihghgqnaagefltrhpdisaitftgesrtgstimka
    vadgvkevsfelggknaavvfadadfdaavagvlrssftnagqvclcservyverpifer
    fvaalkeqaqalrvgapedpattmgplisrghrdkvlsyfrlaveegatvvtgggapsfg
    darddgafvmptiwtglpdsarcvreeifgpvchiapfddeaevvkrvndsayglaasiw
    ttqlarghrvakqietgivwvnawfvrdlrtpfggtklsglgreggrhsldfyseltnvc
    vria