PDB entry 4u2n

View 4u2n on RCSB PDB site
Description: Crystal structure of a complex of the Miz1- and Nac1 POZ domains.
Class: transcription
Keywords: POZ domain, BTB domain, transcription
Deposited on 2014-07-17, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 17,Nucleus accumbens-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NACC1, BTBD14B, NAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13105 (5-End)
      • expression tag (4)
    • Uniprot Q96RE7 (131-End)
      • engineered mutation (227)
    Domains in SCOPe 2.07: d4u2na1, d4u2na2, d4u2na3
  • Chain 'B':
    Compound: Zinc finger and BTB domain-containing protein 17,Nucleus accumbens-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NACC1, BTBD14B, NAC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13105 (5-118)
      • expression tag (4)
      • linker (130)
    • Uniprot Q96RE7 (131-End)
      • engineered mutation (227)
    Domains in SCOPe 2.07: d4u2nb1, d4u2nb2, d4u2nb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u2nA (A:)
    gplgsdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdq
    kdvvhldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalkslar
    sgggssggsgtaqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaa
    sssyfrdlfnnsrsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiq
    eimekgtefflkvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2nA (A:)
    sdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdkdvvh
    ldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalkslaqtlqme
    ipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnnsrsavve
    lpaavqpqsfqqilsfcytgrlsdqdllmytagflqiqeimekgtefflk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u2nB (B:)
    gplgsdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdq
    kdvvhldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalkslar
    sgggssggsgtaqtlqmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaa
    sssyfrdlfnnsrsavvelpaavqpqsfqqilsfcytgrlsmnvgdqdllmytagflqiq
    eimekgtefflkvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2nB (B:)
    sdfpqhsqhvleqlnqqrqlgllcdctfvvdgvhfkahkavlaacseyfkmlfvdqkdvv
    hldisnaaglgqvlefmytaklslspenvddvlavatflqmqdiitachalkslataqtl
    qmeipnfgnsileclneqrlqglycdvsvvvkghafkahravlaasssyfrdlfnnsrsa
    vvelpaavqpqsfqqilsfcytgrlsmndqdllmytagflqiqeimekgtefflk