PDB entry 4u00

View 4u00 on RCSB PDB site
Description: Crystal structure of TTHA1159 in complex with ADP
Class: transport protein
Keywords: ABC amino acid transporter, Nucleotide binding domain, ATP binding protein, TRANSPORT PROTEIN
Deposited on 2014-07-11, released 2015-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid ABC transporter, ATP-binding protein
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: TTHA1159
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u00a_
  • Heterogens: ADP, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u00A (A:)
    mepiirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqege
    vvvdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkal
    ellervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldv
    mrdlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqr
    vlhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u00A (A:)
    piirirnlhkwfgplhvlkgihlevapgeklviigpsgsgkstlirtinrledfqegevv
    vdglsvkddralreirrevgmvfqqfnlfphmtvlenvtlapmrvrrwprekaekkalel
    lervgildqarkypaqlsggqqqrvaiaralamepkimlfdeptsaldpemvgevldvmr
    dlaqggmtmvvvthemgfarevadrvvfmdggqiveegrpeeiftrpkeertrsflqrvl
    h