PDB entry 4tze

View 4tze on RCSB PDB site
Description: Structure of metallo-beta-lactamase
Class: hydrolase
Keywords: Metallo-beta-lactamase, antibiotic resistance, hydrolase
Deposited on 2014-07-10, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B carbapenemase NDM-5
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-5
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3K399 (2-230)
      • expression tag (1)
    Domains in SCOPe 2.07: d4tzea1, d4tzea2
  • Chain 'B':
    Compound: Class B carbapenemase NDM-5
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tzeb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tzeA (A:)
    gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqta
    qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqh
    sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
    nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tzeA (A:)
    pgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqtaq
    ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhs
    ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
    lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tzeB (B:)
    gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqta
    qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqh
    sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
    nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tzeB (B:)
    gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqtaqi
    lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
    tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
    gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr