PDB entry 4tzb

View 4tzb on RCSB PDB site
Description: Structure of NDM-Metallo-beta-lactamase
Class: hydrolase
Keywords: Metallo-beta-lactamase, antibiotic resistance, hydrolase
Deposited on 2014-07-09, released 2015-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9JVE6 (2-230)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4tzba_
  • Heterogens: ZN, CO, NI, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tzbA (A:)
    gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
    qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
    sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
    nlgdadtehyaasvrafgaafpkasmivmshsapdsraaithtarmadklr