PDB entry 4tz9

View 4tz9 on RCSB PDB site
Description: Structure of Metallo-beta-lactamase
Class: hydrolase
Keywords: Metallo-beta-lactamase, antibiotic resistance, hydrolase
Deposited on 2014-07-09, released 2015-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B metallo-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: NDM-3, blaNDM-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3VKD5 (2-230)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d4tz9a1, d4tz9a2
  • Heterogens: ZN, CO, NI, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4tz9A (A:)
gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtndqta
qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr