PDB entry 4tyf

View 4tyf on RCSB PDB site
Description: Structure of a Metallo-beta-lactamase
Class: hydrolase
Keywords: Metallo-Beta-Lactamase, antibiotic resistance, hydrolase
Deposited on 2014-07-08, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ndm-4
    Species: Escherichia coli [TaxId:562]
    Gene: blaNDM-4
    Database cross-references and differences (RAF-indexed):
    • Uniprot X2JGA4 (6-226)
      • expression tag (1-5)
      • expression tag (227-230)
    Domains in SCOPe 2.07: d4tyfa1, d4tyfa2, d4tyfa3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tyfA (A:)
    gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
    qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqh
    sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
    nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tyfA (A:)
    pgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
    ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhs
    ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
    lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr