PDB entry 4txt

View 4txt on RCSB PDB site
Description: Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii
Class: hydrolase
Keywords: Caldicellulosiruptor bescii, GH48, cellobiohydrolase
Deposited on 2014-07-07, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 48
    Species: Caldicellulosiruptor bescii DSM 6725 [TaxId:521460]
    Gene: Athe_1867
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4txta_
  • Heterogens: EDO, BTB, CT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4txtA (A:)
    ptpsstpsvlgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttsea
    fsyyvwleavygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpd
    kypsplefnvpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfint
    fqrgpeesvwetvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqaty
    wakvwakeqgkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyl
    lswyyawggaldgawswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkr
    qiefyrwlqsaegaiaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfq
    awsmqrvaeyyyvtgdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwnga
    ytgnsnlhvkvvdygtdlgitaslanallyysagtkkygvfdegaknlakelldrmwkly
    rdekglsapekradykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpk
    leaayksgqapefryhrfwaqcdiaianatyeilfgnqsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txtA (A:)
    lgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwlea
    vygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpdkypsplefn
    vpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesv
    wetvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakvwakeq
    gkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawgg
    aldgawswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlq
    saegaiaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsmqrvae
    yyyvtgdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgnsnlhv
    kvvdygtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdekglsap
    ekradykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaayksgq
    apefryhrfwaqcdiaianatyeilfg