PDB entry 4txn

View 4txn on RCSB PDB site
Description: Crystal structure of uridine phosphorylase from Schistosoma mansoni in complex with 5-fluorouracil
Class: transferase
Keywords: Uridine phosphorylase, TRANSFERASE
Deposited on 2014-07-03, released 2015-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txna_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txnb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txnc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txnd_
  • Heterogens: SO4, URF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4txnA (A:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txnA (A:)
    vnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglpve
    niagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsgglg
    vkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsvvvg
    gtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltghra
    ilvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4txnB (B:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txnB (B:)
    vnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglpve
    niagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsgglg
    vkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsvvvg
    gtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltghra
    ilvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiiv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4txnC (C:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txnC (C:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsg
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsv
    vvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltg
    hrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4txnD (D:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txnD (D:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsg
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsv
    vvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltg
    hrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr