PDB entry 4txl

View 4txl on RCSB PDB site
Description: Crystal structure of uridine phosphorylase from Schistosoma mansoni in complex with uracil
Class: transferase
Keywords: Uridine phosphorylase, TRANSFERASE
Deposited on 2014-07-03, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txla_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txlb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txlc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: Smp_082430
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txld_
  • Heterogens: SO4, URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4txlA (A:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txlA (A:)
    vnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglpve
    niagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsgglg
    vkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklslecsvvvggtia
    andfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltghrailvc
    vtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4txlB (B:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txlB (B:)
    vnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglalp
    veniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsgg
    lgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlecsvvvg
    gtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltghra
    ilvcvtavnregdqitistdeftlfaqrpgqlvgeylkrnngii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4txlC (C:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txlC (C:)
    ivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglal
    pveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsg
    glgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsv
    vvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltg
    hrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4txlD (D:)
    matvqpivnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismak
    laglalpveniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfi
    rlgtsgglgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenl
    slecsvvvggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaits
    hcyltghrailvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txlD (D:)
    vnshlseldedvfhhfgfttksfdfkekfgdvkfvcvcgssgrihnfaismaklaglalp
    veniagsharfvlykvdhilfadhgmgipsalimlhevtkllhyagckdvlfirlgtsgg
    lgvkpgtivlsdrcvntklepynelcilgkpvrrqtivdlntvnelkklsenlslecsvv
    vggtiaandfyeeqgrldgsictfskeeklaflqsayehgirnmemegtaitshcyltgh
    railvcvtavnrlegdqitistdeftlfaqrpgqlvgeylkrnngiivr