PDB entry 4txe

View 4txe on RCSB PDB site
Description: ScCTS1 in complex with compound 5
Class: hydrolase
Keywords: chitinase, plant-type, inhibitor, hydrolase
Deposited on 2014-07-03, released 2014-08-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endochitinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CTS1, SCW2, YLR286C, L8003.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4txea_
  • Heterogens: 38F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4txeA (A:)
    drsantniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsd
    gllhctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgase
    rpfdsavvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdll
    enadidfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyis
    dtsllestiadiassssfggialwdasqafsnelngepyveilknlltsasqta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4txeA (A:)
    antniavywgqnsagtqeslatycessdadifllsflnqfptlglnfanacsdtfsdgll
    hctqiaedietcqslgkkvllslggasgsylfsddsqaetfaqtlwdtfgegtgaserpf
    dsavvdgfdfdiennnevgysalatklrtlfaegtkqyylsaapqcpypdasvgdllena
    didfafiqfynnycsvsgqfnwdtwltyaqtvspnkniklflglpgsasaagsgyisdts
    llestiadiassssfggialwdasqafsnelngepyveilknlltsas