PDB entry 4tx6

View 4tx6 on RCSB PDB site
Description: AfChiA1 in complex with compound 1
Class: hydrolase
Keywords: plant-type, inhibition, hydrolase
Deposited on 2014-07-02, released 2014-08-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class III chitinase chia1
    Species: Aspergillus fumigatus A1163 [TaxId:451804]
    Gene: AFUB_052270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tx6a_
  • Chain 'B':
    Compound: class III chitinase chia1
    Species: Aspergillus fumigatus A1163 [TaxId:451804]
    Gene: AFUB_052270
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tx6b_
  • Heterogens: 38B, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tx6A (A:)
    rsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tx6A (A:)
    snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
    ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
    gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
    iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
    lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
    dhmkdillh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tx6B (B:)
    rsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
    tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
    fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
    ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
    klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
    adhmkdillh