PDB entry 4tvo

View 4tvo on RCSB PDB site
Description: Structure of Malate Dehydrogenase from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: Krebs cycle, oxidoreductase
Deposited on 2014-06-27, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mdh, RVBD_1240
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6XB21 (Start-328)
      • expression tag (329)
    Domains in SCOPe 2.07: d4tvoa1, d4tvoa2, d4tvoa3
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mdh, RVBD_1240
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tvob1, d4tvob2
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tvoA (A:)
    vsasplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmeldd
    cafpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnav
    aaddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdik
    kmtiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassa
    asaasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgle
    idefsrgridkstaeladersavtelglia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvoA (A:)
    asplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddca
    fpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaa
    ddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdikkm
    tiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassaas
    aasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgleid
    efsrgridkstaeladersavtelglia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tvoB (B:)
    vsasplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmeldd
    cafpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnav
    aaddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdik
    kmtiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassa
    asaasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgle
    idefsrgridkstaeladersavtelglia
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvoB (B:)
    splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
    pllsgveigsdpqkifdgvslallvgarplleangaiftaqgkalnavaaddvrvgvtgn
    pantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdikkmtiwgnhsatq
    ypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassaasaasatidaar
    dwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgleidefsrgridks
    taeladersavtelgli