PDB entry 4tvj

View 4tvj on RCSB PDB site
Description: human artd2 (parp2) - catalytic domain in complex with olaparib
Class: transferase
Keywords: Poly(ADP-Ribose) transferase, Inhibitor, ADP-Ribosylation, TRANSFERASE
Deposited on 2014-06-27, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP2, ADPRT2, ADPRTL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (11-22)
      • conflict (235)
    Domains in SCOPe 2.07: d4tvja1, d4tvja2, d4tvja3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP2, ADPRT2, ADPRTL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGN5 (23-367)
      • expression tag (14-22)
      • conflict (235)
    Domains in SCOPe 2.07: d4tvjb1, d4tvjb2, d4tvjb3
  • Heterogens: 09L, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tvjA (A:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvjA (A:)
    dlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqsl
    kkiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdiei
    aiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtll
    dlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiy
    fadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkma
    pssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tvjB (B:)
    mhhhhhhssgvdlgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgklt
    vaqikagyqslkkiedciragqhgralmeacnefytriphdfglrtpplirtqkelseki
    qllealgdieiaiklvktelqspehpldqhyrnlhcalrpldhesyefkvisqylqstha
    pthsdytmtlldlfevekdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeap
    itgymfgkgiyfadmssksanycfasrlkntgllllsevalgqcnelleanpkaegllqg
    khstkglgkmapssahfvtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmry
    llkvqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tvjB (B:)
    tenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkki
    edciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaik
    lvktspehpldqhyrnlhcalrpldhesyefkvisqylqsthapthsdytmtlldlfeve
    kdgekeafredlhnrmllwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmss
    ksanycfasrlkntgllllsevalgqcnelleanpkaegllqgkhstkglgkmapssahf
    vtlngstvplgpasdtgilnpdgytlnyneyivynpnqvrmryllkvqfnf