PDB entry 4tv6

View 4tv6 on RCSB PDB site
Description: Crystal Structure of Citrate Synthase Variant SbnG E151Q
Class: lyase
Keywords: siderophore biosynthesis, iron, citrate synthase, LYASE
Deposited on 2014-06-26, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyglucarate aldolase
    Species: Staphylococcus aureus [TaxId:426430]
    Gene: sbnG, NWMN_0066
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6QDA6
      • engineered mutation (150)
    Domains in SCOPe 2.07: d4tv6a_
  • Heterogens: OAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tv6A (A:)
    mmqqlslkhrlnngdsvygifnsipdplmieviaasgydfvvidtehvaindetlahlir
    aaeaahiipivrvtavidrdiikvldmgargiivphvkdretvehivklsryypqglrsl
    nggrmarfgrtplldamemanehimviamiqdvegvmaiddiaqvegldmivegaadlsq
    slgipwqtrddqvtshvqhifevvnahgkhfcalpredediakwqaqgvqtfilgddrgk
    iyrhlsaslatskqkgdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tv6A (A:)
    slkhrlnngdsvygifnsipdplmieviaasgydfvvidtehvaindetlahliraaeaa
    hiipivrvtdiikvldmgargiivphvkdretvehivklsryypqglrslhimviamiqd
    vegvmaiddiaqvegldmivegaadlsqslgipwqtrddqvtshvqhifevvnahgkhfc
    alpredediakwqaqgvqtfilgddrgkiyrhlsaslatskqkgd