PDB entry 4tuo

View 4tuo on RCSB PDB site
Description: Crystal structure of monoclonal antibody against neuroblastoma associated antigen.
Class: immune system
Keywords: Neuroblastoma, immune system
Deposited on 2014-06-24, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TUO (0-213)
  • Chain 'B':
    Compound: Light chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TUO (0-End)
    Domains in SCOPe 2.07: d4tuob1, d4tuob2
  • Chain 'C':
    Compound: Heavy chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TUO
  • Chain 'D':
    Compound: Light chain of monoclonal antibody against neuroblastoma associated antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TUO (0-End)
    Domains in SCOPe 2.07: d4tuod1, d4tuod2
  • Heterogens: NA, SIA, GAL, NGA, BGC, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tuoB (B:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tuoB (B:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4tuoD (D:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tuoD (D:)
    dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrn