PDB entry 4ttp

View 4ttp on RCSB PDB site
Description: Crystal structure of Legionella pneumophila dephospho-CoA kinase in apo-form
Class: transferase
Keywords: kinase, P-loop, Coenzyme metabolism, TRANSFERASE
Deposited on 2014-06-22, released 2014-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: coaE, lpg1467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ttpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ttpA (A:)
    mghhhhhhmkeptqmvysvgltgniasgkstvaeffselginviyadkiakeltskntpc
    yqdiishfgssvvlnngeldrkrirdiifsnsnerlwlesllhpvirkkieeqlivctsp
    yclieipllfnkhhypylqkvllviaplesqldrivkrdhctkkqalailatqpnleqrl
    eaaddvlinesglselkakvnklhqkylreakikq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ttpA (A:)
    mvysvgltgniasgkstvaeffselginviyadkiakeltskntpcyqdiishfgssvvl
    nngeldrkrirdiifsnsnerlwlesllhpvirkkieeqlivctspyclieipllfnkhh
    ypylqkvllviaplesqldrivkrdhctkkqalailatqpnleqrleaaddvlinesgls
    elkakvnklhqkylreakikq