PDB entry 4tss

View 4tss on RCSB PDB site
Description: toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form
Deposited on 1996-12-11, released 1997-12-24
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.191
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tss_ (-)
    stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
    kvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkywpkfd
    kkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekpp
    inideiktieaein