PDB entry 4tmz

View 4tmz on RCSB PDB site
Description: Translation initiation factor eIF5B (517-858) from C. thermophilum, bound to GTPgammaS and potassium
Class: translation
Keywords: Translation, Translation factor, GTPase
Deposited on 2014-06-02, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eif5b
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TMZ
    Domains in SCOPe 2.07: d4tmza1, d4tmza2
  • Chain 'B':
    Compound: eif5b
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • PDB 4TMZ
    Domains in SCOPe 2.07: d4tmzb1, d4tmzb2
  • Heterogens: GSP, MG, K, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tmzA (A:)
    ghmnkdnlrspiccilghvdtgktklldkirqtnvqegeaggitqqigatyfpveaikqk
    tavvnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtiesl
    rllrerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeq
    gfnselfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmylselqatvl
    evkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmrelrikgqyih
    hkevkaaqgvkisapglegaiagsrllvvgpdddeeeleeevesd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tmzA (A:)
    hmnkdnlrspiccilghvdtgktklldkirqtnvqegeaggitqqigatyfpveaikqkt
    avvnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtieslr
    llrerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeqg
    fnselfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmylselqatvle
    vkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmrelrikgqyihh
    kevkaaqgvkisapglegaiagsrllvvgpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tmzB (B:)
    ghmnkdnlrspiccilghvdtgktklldkirqtnvqegeaggitqqigatyfpveaikqk
    tavvnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtiesl
    rllrerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeq
    gfnselfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmylselqatvl
    evkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmrelrikgqyih
    hkevkaaqgvkisapglegaiagsrllvvgpdddeeeleeevesd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tmzB (B:)
    hmnkdnlrspiccilghvdtgktklldkirqtnvqegeaggitqqigatyfpveaikqkt
    avvnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtieslr
    llrerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeqg
    fnselfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmylselqatvle
    vkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmrelrikgqyihh
    kevkaaqgvkisapglegaiagsrllvvgpdd