PDB entry 4tm5

View 4tm5 on RCSB PDB site
Description: X-ray crystal structure of a D-amino acid aminotransferase from Burkholderia thailandensis E264 bound to the co-factor pyridoxal phosphate
Class: transferase
Keywords: D-amino acid, aminotransferase, PLP, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2014-05-31, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid aminotransferase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I0381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tm5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tm5A (A:)
    mahhhhhhmsqadiepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaega
    rrapfriaqhlarlarslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvt
    rgvakrghafpanavptvfamasplalptdaqraqgvhcvtaedrrwlhcdiksvsllgn
    vlmaqhaaehdaaetiqlrdgnvtegsssnvwivkngeliapprsnrilegiryalveel
    aeecgirfvareineaelraadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaay
    qrakahemesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tm5A (A:)
    iepivylsvasreelvplsearvpvldrgfifgdgvyevvpiyaegarrapfriaqhlar
    larslkkigiadphdeagwralvarlvdanaaalgdgqhaivyiqvtrgvakrghafpan
    avptvfamasplalptdaqraqgvhcvtaedrrwlhcdiksvsllgnvlmaqhaaehdaa
    etiqlrdgnvtegsssnvwivkngeliapprsnrilegiryalveelaeecgirfvarei
    neaelraadeilltsatkeilpvtrlddlpvqggrpgpvfdalyaayqrakaheme