PDB entry 4tlq

View 4tlq on RCSB PDB site
Description: Crystal structure of C-terminal RNA recognition motif of human ELAV type RNA binding protein-3 at 2.5 Angstrom resolution
Class: RNA binding protein
Keywords: RRM, RNA binding protein
Deposited on 2014-05-30, released 2015-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUGBP Elav-like family member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tlqa_
  • Chain 'B':
    Compound: CUGBP Elav-like family member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CELF2, BRUNOL3, CUGBP2, ETR3, NAPOR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tlqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4tlqA (A:)
    gshmqkegpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsy
    dnpvsaqaaiqamngfqigmkrlkvqlkrskndskpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tlqA (A:)
    egpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsa
    qaaiqamngfqigmkrlkvqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4tlqB (B:)
    gshmqkegpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsy
    dnpvsaqaaiqamngfqigmkrlkvqlkrskndskpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4tlqB (B:)
    egpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsa
    qaaiqamngfqigmkrlkvqlkr