PDB entry 4tkb

View 4tkb on RCSB PDB site
Description: The 0.86 angstrom X-ray structure of the human heart fatty acid-binding protein complexed with lauric acid
Class: lipid binding protein
Keywords: human, fatty acid-binding protein, antiparallel beta barrel, LIPID BINDING PROTEIN
Deposited on 2014-05-26, released 2015-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.109
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4tkba_
  • Heterogens: DAO, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tkbA (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyekea