PDB entry 4tjz

View 4tjz on RCSB PDB site
Description: The 0.87 angstrom X-ray structure of the human heart fatty acid-binding protein complexed with capric acid
Class: lipid binding protein
Keywords: Fatty acid-binding protein, Antiparallel beta barrel, human, heart, decanoic acid, LIPID BINDING PROTEIN
Deposited on 2014-05-25, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 0.87 Å
R-factor: 0.109
AEROSPACI score: 1.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4tjza_
  • Heterogens: DKA, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tjzA (A:)
    mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
    teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
    gtavctrtyekea