PDB entry 4tgf

View 4tgf on RCSB PDB site
Description: solution structures of human transforming growth factor alpha derived from 1*h nmr data
Class: growth factor
Keywords: growth factor
Deposited on 1990-06-13, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: des-val-1,val-2,transforming growth factor, alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4tgfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4tgfA (A:)
    vvshfndcpdshtqfcfhgtcrflvqedkpacvchsgyvgarcehadlla