PDB entry 4sli

View 4sli on RCSB PDB site
Description: leech intramolecular trans-sialidase complexed with 2-propenyl-neu5ac, an inactive substrate analogue
Class: enzyme
Keywords: enzyme, intramolecular trans-sialidase
Deposited on 1998-10-04, released 1999-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intramolecular trans-sialidase
    Species: Macrobdella decora [TaxId:6405]
    Gene: T7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4slia1, d4slia2
  • Heterogens: CNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4sliA (A:)
    ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
    tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
    nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
    alsdeeliqatgvttygenifyagdvtesnyfripslltlstgtvisaadaryggthdsk
    skiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiqgsasyidpvlle
    dkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgvi
    yndatnqptefrvdgeynlyqhdtnltckqydynfsgnnliesktdvdvnmnifyknsvf
    kafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvpl
    yskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktylrtgsnciaev
    tsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwi
    glvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelh
    lkdilkfekysiseltgqa