PDB entry 4s3o

View 4s3o on RCSB PDB site
Description: PCGF5-RING1B-UbcH5c complex
Class: Ligase/Transcription
Keywords: E2, E3, RING domain, Ubiquitin RING E3 Ligase, Ligase-Transcription complex
Deposited on 2015-03-23, released 2015-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D3, UBC5C, UBCH5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (2-147)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4s3oa1, d4s3oa2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase RING2
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF2, BAP1, DING, HIPI3, RING1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Polycomb group RING finger protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: PCGF5, RNF159
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D3, UBC5C, UBCH5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (2-147)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4s3od1, d4s3od2
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase RING2
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF2, BAP1, DING, HIPI3, RING1B
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Polycomb group RING finger protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: PCGF5, RNF159
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s3oA (A:)
    gsalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptd
    ypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddpl
    vpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s3oD (D:)
    gsalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptd
    ypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddpl
    vpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.