PDB entry 4s2m

View 4s2m on RCSB PDB site
Description: Crystal Structure of OXA-163 complexed with iodide in the active site
Class: hydrolase
Keywords: globular, hydrolase
Deposited on 2015-01-21, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2ma_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2mb_
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2mc_
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2md_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s2mA (A:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s2mA (A:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmpglrqaitkevlkqekiip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s2mB (B:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s2mB (B:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmpglglrqaitkevlkqekiip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4s2mC (C:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s2mC (C:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmpglglrqaitkevlkqekiip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s2mD (D:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s2mD (D:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsglrqaitkevlkqekiip