PDB entry 4s2l

View 4s2l on RCSB PDB site
Description: Crystal Structure of OXA-163 beta-lactamase
Class: Hydrolase
Keywords: globular, Hydrolase, carbamylation
Deposited on 2015-01-21, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2la_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: blaOXA-163
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4s2lb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s2lA (A:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s2lB (B:)
    wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
    vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
    gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
    iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip