PDB entry 4s17

View 4s17 on RCSB PDB site
Description: The crystal structure of glutamine synthetase from Bifidobacterium adolescentis ATCC 15703
Class: ligase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, LIGASE
Deposited on 2015-01-08, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17a1, d4s17a2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17b1, d4s17b2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17c1, d4s17c2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17d1, d4s17d2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17e1, d4s17e2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bifidobacterium adolescentis [TaxId:367928]
    Gene: BAD_0943, glnA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4s17f1, d4s17f2
  • Heterogens: MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s17A (A:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17A (A:)
    letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
    sdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkaeaylkstgiad
    tasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkgy
    fpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmkyk
    yvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknygglsdlarwyi
    gglikhsssvlaftnpslnsyhrlvpgapvnlvysarnrsaairippaakriefrapdps
    cnpflafsaqlmagldgilnhieppapvagikqvpsslaeamdaleedhdfltagdvftd
    dlidtwisikrgeidqarlaptpleyelyfhi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s17B (B:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17B (B:)
    letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
    sdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkaeaylkstgiad
    tasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkgy
    fpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmkyk
    yvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknygglsdlarwyi
    gglikhsssvlaftnpslnsyhrlvpgapvnlvysarnrsaairippaakriefrapdps
    cnpflafsaqlmagldgilnhieppapvgikqvpsslaeamdaleedhdfltagdvftdd
    lidtwisikrgeidqarlaptpleyelyfhi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4s17C (C:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17C (C:)
    aletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegf
    qsdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkaeaylkstgia
    dtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkg
    yfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmky
    kyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydglsdlarwyiggli
    khsssvlaftnpslnsyhrlvpapvnlvysarnrsaairippaakriefrapdpscnpfl
    afsaqlmagldgilnhieppapvagikqvpsslaeamdaleedhdfltagdvftddlidt
    wisikrgeidqarlaptpleyelyfhi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s17D (D:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17D (D:)
    aletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegf
    qdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkaeaylkstgiad
    tasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkgy
    fpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmkyk
    yvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfyknygglsdlarwyigg
    likhsssvlaftnpslnsyhrlvpeapvnlvysarnrsaairippaakriefrapdpscn
    pflafsaqlmagldgilnhieppapvagikqvpsslaeamdaleedhdfltagdvftddl
    idtwisikrgeidqarlaptpleyelyfhi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4s17E (E:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17E (E:)
    letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
    dmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkaeaylkstgiadt
    asfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkgyf
    pvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmkyky
    vvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydnygglsdlarwyiggl
    ikhsssvlaftnpslnsyhrlvpgfapvnlvysarnrsaairippaakriefrapdpscn
    pflafsaqlmagldgilnhieppapvagikqvpsslaeamdaleedhdfltagdvftddl
    idtwisikrgeidqarlaptpleyelyfhi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4s17F (F:)
    snamtaletkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgs
    svegfqainesdmklvpdvstafidpfrkhktldvafsivdpltdepysrdprqvagkae
    aylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpni
    afknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslq
    hagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknyg
    glsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysarnrsaairipla
    gtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkdlyelppeehagi
    kqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfh
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s17F (F:)
    letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
    dmklvpdvstafidpfrkhktldvafsivdpdepysrdprqvagkaeaylkstgiadtas
    fapeaeffifdkvrfensmqrsfyevdsieapwnsgidteddgtpniafknrvkkgyfpv
    ppidhtqdlrddmvanlqkvglilershhevagagqqeinyrfnslqhagddlmkykyvv
    hetaalagkaatfmpkpiagdngtgmhchqslwkdgkplfydeknygglsdlarwyiggl
    ikhsssvlaftnpslnsyhrlvpgapvnlvysarnrsaairippaakriefrapdpscnp
    flafsaqlmagldgilnhieppapvagikqvpsslaeamdaleedhdfltagdvftddli
    dtwisikrgeidqarlaptpleyelyfhi