PDB entry 4s11

View 4s11 on RCSB PDB site
Description: Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
Class: immune system
Keywords: nanobody, immune system
Deposited on 2015-01-07, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin nanobody
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4S11 (Start-129)
    Domains in SCOPe 2.07: d4s11a1, d4s11a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4s11A (A:)
    qvqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtry
    adsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqg
    tqvtvsshhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s11A (A:)
    vqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtrya
    dsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgt
    qvtvsshhh