PDB entry 4rzq

View 4rzq on RCSB PDB site
Description: Structural Analysis of Substrate, Reaction Intermediate and Product Binding in Haemophilus influenzae Biotin Carboxylase
Class: ligase
Keywords: ATP Grasp, Carboxylase, Biotin Carboxyl Carrier Protein and Carboxyltransferase, LIGASE
Deposited on 2014-12-23, released 2015-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Haemophilus influenzae Rd KW20 [TaxId:71421]
    Gene: accC, HI_0972
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43873 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d4rzqa1, d4rzqa2, d4rzqa3, d4rzqa4
  • Heterogens: Y7Y, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rzqA (A:)
    mgsshhhhhhssglvprgshmlekvvianrgeialrilrackelgiktvavhstadrdlk
    hvlladeticigpapsaksylnipaiiaaaevtgadaihpgygflsenadfaeqversgf
    tfigptadvirlmgdkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiika
    sgggggrgmrvvrsedaleesiamtkaeakaafnndmvymekylenprhveiqvladthg
    navylaerdcsmqrrhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflye
    ngefyfiemntriqvehpvtemitgvdlvkeqlriaaglpisfkqedikvkghamecrin
    aedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklitygdtrevair
    rmqnalsetiidgiktniplheliledenfqkggtnihylekklgmne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rzqA (A:)
    hmlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaks
    ylnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmgdkvsa
    ikamkkagvpcvpgsdgpaknkeiakrigypiiikrvvrsedaleesiamtkaeymekyl
    enprhveiqvladthgnavylaerdcsmqrrhqkvveeapapgiteevrrdigsrcanac
    veigyrgagtfeflyengefyfiemntriqvehpvtemitgvdlvkeqlriaaglpisfk
    qedikvkghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsm
    iaklitygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekkl
    gm