PDB entry 4rxn

View 4rxn on RCSB PDB site
Description: crystallographic refinement of rubredoxin at 1.2 angstroms resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1984-10-15, released 1985-04-01
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-07-20.
Experiment type: -
Resolution: 1.2 Å
R-factor: 0.128
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-53)
      • conflict (13)
      • conflict (21)
      • conflict (47)
    Domains in SCOP 1.73: d4rxna_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rxnA (A:)
    mkkytctvcgyiydpedgdpddgvnpgtdfkdipddwvcplcgvgkdefeevee