PDB entry 4rx9

View 4rx9 on RCSB PDB site
Description: SYK Catalytic Domain Complexed with a Potent Pyrimidine Inhibitor
Class: transferase/transferase inhibitor
Keywords: TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-12-09, released 2015-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • conflict (114)
      • expression tag (283-286)
    Domains in SCOPe 2.07: d4rx9a1, d4rx9a2
  • Heterogens: GOL, 3YT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rx9A (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvtdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rx9A (A:)
    vyldrklltledkelgfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqqldnp
    yivrmigiceaeswmlvmemaelgplnkylqqnrhvtdkniielvhqvsmgmkyleesnf
    vhrdlaarnvllvtqhyakisdfglskalradenyykaqtgkwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrnyyydvvnhhhh