PDB entry 4rx3

View 4rx3 on RCSB PDB site
Description: A triple mutant in the omega-loop of TEM-1 beta-lactamase changes the substrate profile via a large conformational change and an altered general base for catalysis
Class: hydrolase
Keywords: globular, beta-lactamase, hydrolase
Deposited on 2014-12-08, released 2015-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered mutation (44)
      • engineered mutation (139-141)
    Domains in SCOPe 2.05: d4rx3a_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rx3A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmgtfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldryygelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw