PDB entry 4rwt

View 4rwt on RCSB PDB site
Description: Structure of actin-Lmod complex
Class: structural protein
Keywords: leucine rich region, actin nucleation, actin, STRUCTURAL PROTEIN
Deposited on 2014-12-05, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-5C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Act5C, CG4027
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10987 (Start-375)
      • engineered mutation (291)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4rwta1, d4rwta2
  • Chain 'B':
    Compound: Actin-5C
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Act5C, CG4027
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10987 (Start-375)
      • engineered mutation (291)
      • engineered mutation (322)
    Domains in SCOPe 2.07: d4rwtb1, d4rwtb2
  • Chain 'C':
    Compound: Leiomodin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LMOD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rwtc_
  • Chain 'D':
    Compound: Leiomodin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: LMOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5Q4 (Start-505)
      • engineered mutation (436-439)
      • engineered mutation (441-442)
      • engineered mutation (444-445)
  • Heterogens: ANP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rwtA (A:)
    mcdeevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaq
    skrgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekm
    tqimfetfntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrld
    lagrdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleks
    yelpdgqvitignerfrcpealfqpsflgmeacgihettynsimkcdvdiredlyantvl
    sggttmypgiadrmqkeitalakstmkikiiapperkysvwiggsilaslstfqqmwisk
    qeydesgpsivhrkcfashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rwtA (A:)
    alvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
    lkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfet
    fntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrldlagrdlt
    dylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksyelpdgq
    vitignerfrcpealfqpsflgmeacgihettynsimkcdvdiredlyantvlsggttmy
    pgiadrmqkeitalakstmkikiiapperkysvwiggsilaslstfqqmwiskqeydesg
    psivhrkcf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rwtB (B:)
    mcdeevaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaq
    skrgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekm
    tqimfetfntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrld
    lagrdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleks
    yelpdgqvitignerfrcpealfqpsflgmeacgihettynsimkcdvdiredlyantvl
    sggttmypgiadrmqkeitalakstmkikiiapperkysvwiggsilaslstfqqmwisk
    qeydesgpsivhrkcfashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rwtB (B:)
    alvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
    lkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfet
    fntpamyvaiqavlslyasgrttgivldsgdgvshtvpiyegyalphailrldlagrdlt
    dylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksyelpdgq
    vitignerfrcpealfqpsflgmeacgihettynsimkcdvdiredlyantvlsggttmy
    pgiadrmqkeitalakstmkikiiapperkysvwiggsilaslstfqqmwiskqeydesg
    psivhrkcf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rwtC (C:)
    mahhhhhhvgtmstfgyrrglskyesidedellaslsaeelkelerelediepdrnlpvg
    lrqksltektptgtfsrealmaywekesqkllekerlgecgkvaedkeeeedsdeeerti
    etakgingtvnydsvnsdnskpkifksqieninltngsngrntespaaihpcgnptvied
    aldkiksndpdttevnlnnienittqtltrfaealkdntvvktfslanthaddsaamaia
    emlkvnehitnvnvesnfitgkgilaimralqhntvltelrfhnqrhimgsqvemeivkl
    lkenttllrlgyhfelpgprmsmtsiltrnmdkqrqkrlqeqkqqegydggpnlrtkvwq
    rgtpssspyvsprhspwsspklpkkvqtvrsrplspvatpppppppplpekklitrniae
    vikqqesaqralqngqgsgsggsvgsqpnsilkeiknslrsvqekkmedssrpstpqrsa
    henlmeairgssikqlkrvevpealr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rwtC (C:)
    viedaldkiksndpdttevnlnnienittqtltrfaealkdntvvktfslanthaddsaa
    maiaemlkvnehitnvnvesnfitgkgilaimralqhntvltelrfhnqrhimgsqveme
    ivkllkenttllrlgyhfelpgprmsmtsiltrnmdkqrqkrlqeqkq
    

  • Chain 'D':
    No sequence available.