PDB entry 4rub

View 4rub on RCSB PDB site
Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state
Class: lyase(carbon-carbon)
Keywords: lyase(carbon-carbon)
Deposited on 1990-05-25, released 1992-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ruba1, d4ruba2
  • Chain 'B':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rubb1, d4rubb2
  • Chain 'C':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rubc1, d4rubc2
  • Chain 'D':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rubd1, d4rubd2
  • Chain 'S':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69249 (0-122)
      • conflict (87)
    Domains in SCOPe 2.06: d4rubs_
  • Chain 'T':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69249 (0-122)
      • conflict (87)
    Domains in SCOPe 2.06: d4rubt_
  • Chain 'U':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69249 (0-122)
      • conflict (87)
    Domains in SCOPe 2.06: d4rubu_
  • Chain 'V':
    Compound: ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69249 (0-122)
      • conflict (87)
    Domains in SCOPe 2.06: d4rubv_
  • Heterogens: MG, CAP, FMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rubA (A:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rubA (A:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rubB (B:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rubB (B:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rubC (C:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rubC (C:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rubD (D:)
    mspqtetkasvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsr
    giyftqdwvslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvkarnegrdlaqegneiireackwspelaaacevwkeivfnfaavdvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rubD (D:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubT (T:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubU (U:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubV (V:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy