PDB entry 4rub

View 4rub on RCSB PDB site
Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state
Deposited on 1990-05-25, released 1992-10-15
The last revision prior to the SCOP 1.59 freeze date was dated 1994-04-30, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubA (A:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubB (B:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubC (C:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubD (D:)
    asvgfkagvkeykltyytpeyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwtt
    vwtdgltsldrykgrcyriervvgekdqyiayvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    emikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhg
    ihfrvlakalrmsggdhihsgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdw
    vslpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    karnegrdlaqegneiireackwspelaaacevwkeivfnfaavd
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubS (S:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubT (T:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubU (U:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rubV (V:)
    mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
    yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
    egy