PDB entry 4rsu

View 4rsu on RCSB PDB site
Description: Crystal structure of the light and hvem complex
Class: immune system
Keywords: STRUCTURAL GENOMICS, PSI-BIOLOGY, NEW YORK STRUCTURAL GENOMICS, RESEARCH CONSORTIUM, NYSGRC, IMMUNITY, N-GLYCOSYLATION, MEMBRANE, SECRETED PROTEIN, CYTOKINE, IFN, JELLY-ROLL FOLD, Protein Structure Initiative, Atoms-to-Animals: The Immune Function Network, cysteine rich domain, signaling, cell membrane, secreted, IMMUNE SYSTEM
Deposited on 2014-11-11, released 2015-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsua_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsub_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsuc_
  • Chain 'D':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92956 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d4rsud1, d4rsud2, d4rsud3
  • Chain 'E':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92956 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4rsue1, d4rsue2, d4rsue3
  • Chain 'F':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92956 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d4rsuf1, d4rsuf2, d4rsuf3
  • Chain 'G':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsug_
  • Chain 'H':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsuh_
  • Chain 'I':
    Compound: Tumor necrosis factor ligand superfamily member 14, soluble form
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFSF14, HVEML, LIGHT, UNQ391/PRO726
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43557 (Start-164)
      • conflict (138)
    Domains in SCOPe 2.06: d4rsui_
  • Chain 'J':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92956 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4rsuj1, d4rsuj2, d4rsuj3
  • Chain 'K':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92956 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4rsuk1, d4rsuk2, d4rsuk3
  • Chain 'L':
    Compound: Tumor necrosis factor receptor superfamily member 14
    Species: Homo sapiens [TaxId:9606]
    Gene: TNFRSF14, HVEA, HVEM, UNQ329/PRO509
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rsul1, d4rsul2
  • Heterogens: CL, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rsuA (A:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuA (A:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
    geevvvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rsuB (B:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuB (B:)
    evnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlg
    gvgcstithglykrtprypeelellvsqqspctsssrvwwdssflggvvhleageevvvr
    vlderlvrlrdgtrsyfgafmv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rsuC (C:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuC (C:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgctithglykrtprypeelellvsqqspcssrvwwdssflggvvhleageevvvrvlde
    rlvrlrdgtrsyfgafmv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rsuD (D:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuD (D:)
    slpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq
    mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacraya
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4rsuE (E:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuE (E:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivhcaacray
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4rsuF (F:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuF (F:)
    slpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq
    mcdpamglrasrncsrtenavcgcspghfcivcaacra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4rsuG (G:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuG (G:)
    evnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlg
    gvgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhle
    ageevvvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4rsuH (H:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuH (H:)
    evnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlg
    gvgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhle
    ageevvvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4rsuI (I:)
    hhhhhhgliqerrshevnpaahltganssltgsggpllwetqlglaflrglsyhdgalvv
    tkagyyyiyskvqlggvgcplglastithglykrtprypeelellvsqqspcgratsssr
    vwwdssflggvvhleageevvvrvlderlvrlrdgtrsyfgafmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuI (I:)
    vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
    vgcplastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleage
    evvvrvlderlvrlrdgtrsyfgafmv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4rsuJ (J:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuJ (J:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacraya
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4rsuK (K:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuK (K:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacraya
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4rsuL (L:)
    rslpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqc
    qmcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacrayatsspgqrvqkggte
    sqdtlctghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rsuL (L:)
    sckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcqmcd
    pamglrasrncsrtenavcgcspghfcivqdgdhcaacrayats