PDB entry 4rrt

View 4rrt on RCSB PDB site
Description: Crystal structure of a human cytochrome P450 2B6 (Y226H/K262R) in complex with (+)-3-carene
Class: oxidoreductase
Keywords: P450, cytochrome P450 2B6, monooxygenase, membrane protein, CYP2B6, endoplasmic reticulum, heme, iron, metal binding, microsome, OXIDOREDUCTASE
Deposited on 2014-11-06, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2B6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20813 (Start-471)
      • engineered mutation (9)
      • engineered mutation (206)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d4rrta_
  • Chain 'B':
    Compound: Cytochrome P450 2B6
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2B6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20813 (Start-471)
      • engineered mutation (9)
      • engineered mutation (206)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d4rrtb_
  • Heterogens: HEM, 3V4, CM5, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rrtA (A:)
    makktsskgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlc
    gveairealvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgk
    rsveeriqeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkml
    nlfyqtfslissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldps
    aprdlidtyllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyph
    vaervyreieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrg
    yiipkdtevflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclge
    giaraelflffttilqnfsmaspvapedidltpqecgvgkipptyqirflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rrtA (A:)
    gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
    lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfkrsveeriqeea
    qclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslis
    svfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyll
    hmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieq
    vigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevfl
    ilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflff
    ttilqnfsmaspvapedidltpqecgvgkipptyqirflpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rrtB (B:)
    makktsskgklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlc
    gveairealvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgk
    rsveeriqeeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkml
    nlfyqtfslissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldps
    aprdlidtyllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyph
    vaervyreieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrg
    yiipkdtevflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclge
    giaraelflffttilqnfsmaspvapedidltpqecgvgkipptyqirflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rrtB (B:)
    gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
    lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfkrsveeriqeea
    qclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslis
    svfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyll
    hmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieq
    vigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevfl
    ilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflff
    ttilqnfsmaspvapedidltpqecgvgkipptyqirflpr