PDB entry 4ros

View 4ros on RCSB PDB site
Description: Crystal structure of Methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
Class: oxidoreductase
Keywords: Dehydrogenase, OXIDOREDUCTASE
Deposited on 2014-10-28, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Methylobacterium extorquens [TaxId:419610]
    Gene: mdh, Mext_1643
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4rosa1, d4rosa2
  • Heterogens: CA, OAA, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rosA (A:)
    marskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdaky
    sgasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicit
    npldamvwalqkfsglptnkvvgmagvldsarfrhflaeefgvsvedvtafvlgghgddm
    vpltrystvagvpltdlvklgwttqekldamvertrkgggeivnllktgsafyapaasai
    amaesylrdkkrvlpcaayldgqygidglyvgvpvvigengvervlevtfnddekamfek
    svnsvkglieacksvndkla
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rosA (A:)
    arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
    gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
    pldamvwalqkfsglptnkvvgmagvldsarfrhflaeefgvsvedvtafvlgghgddmv
    pltrystvagvpltdlvklgwttqekldamvertrkgggeivnllktgsafyapaasaia
    maesylrdkkrvlpcaayldgqygidglyvgvpvvigengvervlevtfnddekamfeks
    vnsvkglieacksvndkl