PDB entry 4rnl

View 4rnl on RCSB PDB site
Description: The crystal structure of a possible galactose mutarotase from Streptomyces platensis subsp. rosaceus
Class: structural genomics, unknown function
Keywords: structural genomics, PSI-Biology, MCSG, Enzyme Discovery for Natural Product Biosynthesis, NatPro, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2014-10-24, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: possible galactose mutarotase
    Species: Streptomyces platensis subsp. rosaceus [TaxId:58346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNL (Start-342)
    Domains in SCOPe 2.07: d4rnla_
  • Chain 'B':
    Compound: possible galactose mutarotase
    Species: Streptomyces platensis subsp. rosaceus [TaxId:58346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNL (Start-342)
    Domains in SCOPe 2.07: d4rnlb_
  • Chain 'C':
    Compound: possible galactose mutarotase
    Species: Streptomyces platensis subsp. rosaceus [TaxId:58346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNL (Start-342)
    Domains in SCOPe 2.07: d4rnlc_
  • Chain 'D':
    Compound: possible galactose mutarotase
    Species: Streptomyces platensis subsp. rosaceus [TaxId:58346]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4RNL (Start-342)
    Domains in SCOPe 2.07: d4rnld_
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rnlA (A:)
    snamrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgql
    algfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfs
    rvvwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnlt
    nhtylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravaga
    ydhnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpyg
    paaglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rnlA (A:)
    amrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlal
    gfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrv
    vwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnh
    tylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagayd
    hnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpa
    aglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rnlB (B:)
    snamrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgql
    algfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfs
    rvvwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnlt
    nhtylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravaga
    ydhnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpyg
    paaglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rnlB (B:)
    namrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqla
    lgfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsr
    vvwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltn
    htylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagay
    dhnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygp
    aaglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4rnlC (C:)
    snamrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgql
    algfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfs
    rvvwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnlt
    nhtylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravaga
    ydhnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpyg
    paaglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rnlC (C:)
    amrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlal
    gfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrv
    vwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnh
    tylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagayd
    hnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpa
    aglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4rnlD (D:)
    snamrtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgql
    algfadlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfs
    rvvwdarevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnlt
    nhtylnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravaga
    ydhnfaldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpyg
    paaglaletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rnlD (D:)
    rtqvsrepfgtlddgtrvdrwtlesgpaglrvrvltyggivqtveapdrdgmrgqlalgf
    adlasyaahggsyfgalvgryanriagasfvldgrtdaltpnngrhslhggpggfsrvvw
    darevdggvqlhrvspdgeegfpgaldvrvtytlsagalrivscattdaptvvnltnhty
    lnlggdgsgsaaghelrlaasrytpvdgtgipvpgapaevtgtrfdfraaravagaydhn
    faldggvreaprtvaelydprsgralalattepglqlytadhldgtltgtsgvpygpaag
    laletqhfpdspnrpdfpstvlrpgesyrsetvyafsvr