PDB entry 4rna

View 4rna on RCSB PDB site
Description: Crystal structure of PLpro from Middle East Respiratory Syndrome (MERS) coronavirus
Class: hydrolase
Keywords: MERS, coronavirus, papain-like protease, PLpro, HYDROLASE
Deposited on 2014-10-23, released 2015-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-01, with a file datestamp of 2015-06-26.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain-like protease
    Species: Human betacoronavirus 2c EMC/2012 [TaxId:1235996]
    Gene: orf1ab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rnaa1, d4rnaa2
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rnaA (A:)
    gpqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslylad
    nltadetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavim
    tldllkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakae
    lccsarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlve
    httpwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvs
    ktsdwkckvtdvlfpgqkyssdcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rnaA (A:)
    ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt
    adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
    llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
    sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
    pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
    dwkckvtdvlfpgqkyssdcn