PDB entry 4rn7

View 4rn7 on RCSB PDB site
Description: The crystal structure of N-acetylmuramoyl-L-alanine amidase from Clostridium difficile 630
Class: hydrolase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, HYDROLASE
Deposited on 2014-10-23, released 2014-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylmuramoyl-l-alanine amidase
    Species: Peptoclostridium difficile [TaxId:272563]
    Gene: CD630_27610
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q183J9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4rn7a1, d4rn7a2
  • Heterogens: ZN, GOL, EPE, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rn7A (A:)
    snaytvfidpghggndkgtesktsnryekdlnlqiakklanklskqkdiqvvvsrtddty
    islkdrailannssadvlvsihlnaekngntatgietwyrnkatdgskelaqtvqstivs
    yvkvrdrgivennfevlresnmpailiecgflttpseeqkiinekyqdqlaegivqgvls
    yldskgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rn7A (A:)
    snaytvfidpghggndkgtesktsnryekdlnlqiakklanklskqkdiqvvvsrtddty
    islkdrailannssadvlvsihlnaekngntatgietwyrnkatdgskelaqtvqstivs
    yvkvrdrgivennfevlresnmpailiecgflttpseeqkiinekyqdqlaegivqgvls
    yldskg