PDB entry 4rma

View 4rma on RCSB PDB site
Description: Crystal structure of the FERM domain of human ezrin
Class: peptide binding protein
Keywords: ERM, ezrin, FERM domain, membrane cytoskeleton linkers, PEPTIDE BINDING PROTEIN
Deposited on 2014-10-21, released 2015-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ezrin
    Species: Homo sapiens [TaxId:9606]
    Gene: EZR, VIL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rmaa1, d4rmaa2, d4rmaa3
  • Chain 'B':
    Compound: Ezrin
    Species: Homo sapiens [TaxId:9606]
    Gene: EZR, VIL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4rmab1, d4rmab2, d4rmab3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rmaA (A:)
    mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlk
    ldkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppe
    tavllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehr
    gmlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rmaA (A:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehrg
    mlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfp
    wseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4rmaB (B:)
    mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlk
    ldkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppe
    tavllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehr
    gmlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rmaB (B:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdygyerlipqrvmdqhkltrdqwedriqvwhaehrgmlkdnamley
    lkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnisfn
    dkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrk