PDB entry 4rm7

View 4rm7 on RCSB PDB site
Description: The crystal structure of acyl-COA dehydrogenase from Slackia heliotrinireducens DSM 20476
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, ALPHA FOLD, CYTOSOLIC
Deposited on 2014-10-20, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.176
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Slackia heliotrinireducens [TaxId:471855]
    Gene: Shel_09270
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7N4Y3 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4rm7a1, d4rm7a2, d4rm7a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4rm7A (A:)
    snamydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvi
    hrrnhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtg
    rlsyalaisepeagsdtrsmrthvtregdtlvmngtkmfvnngeyapallvsaydktgdd
    gepefsfwmvprsaagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgsskgfsqlys
    lleygrvftcaaalgeaqaamedavawargreafgqriadlqqvqmkltemevkltnmrn
    lvygaareydrgehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrvssiwqdcr
    gyqfadgtdevmvviaaplileqykasknnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4rm7A (A:)
    namydglsrdeqrllnhvreygekyftpasiskwrkdqglpdevvkafvdldfngfgvih
    rrnhrtydlfaqvlvieelsrisgaclpfqndllqlqileafassaqtspfrteyqdtgr
    lsyalaisepemrthvtregdtlvmngtkmfvnngeyapallvsaydktgddpefsfwmv
    prsaagiyaypeqkigqsmlpfatvrfdnvevkeswrlkgsskgfsqlyslleygrvftc
    aaalgeaqaamedavawargreaqriadlqqvqmkltemevkltnmrnlvygaareydrg
    ehkrlsvalmkyyvpkaatevasdamqilggrgyiqenrvssiwqdcrgyqfadgtdevm
    vviaaplileqykas