PDB entry 4rkd

View 4rkd on RCSB PDB site
Description: Psychrophilic aromatic amino acids aminotransferase from Psychrobacter sp. B6 cocrystalized with aspartic acid
Class: transferase
Keywords: AMINOTRANSFERASE, AROMATIC SUBSTRATES, PLP dependent ENZYME, TRANSFERASE
Deposited on 2014-10-12, released 2015-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkda_
  • Chain 'B':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdb_
  • Chain 'C':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdc_
  • Chain 'D':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdd_
  • Chain 'E':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkde_
  • Chain 'F':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdf_
  • Chain 'G':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdg_
  • Chain 'H':
    Compound: aromatic amino acid aminotransferase
    Species: Psychrobacter sp. B6 [TaxId:408968]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4rkdh_
  • Heterogens: MG, PLP, KET, OAA, PMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdA (A:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdB (B:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdC (C:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdD (D:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdE (E:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdF (F:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdG (G:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4rkdH (H:)
    mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
    sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
    skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
    chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
    snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
    aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
    lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd