PDB entry 4rkb

View 4rkb on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V66T/V99T at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, hydrolase, pdtp, cavity, pressure
Deposited on 2014-10-12, released 2014-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • conflict (43-44)
      • conflict (59)
      • conflict (92)
      • conflict (110)
      • conflict (121)
    Domains in SCOPe 2.08: d4rkba_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4rkbA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmt
enakkievefdkgqrtdkygrglayiyadgkmtnealvrqglakvayvykgnntheqllr
kaeaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4rkbA (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmtenakki
evefdkgqrtdkygrglayiyadgkmtnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws